PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf08351g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 320aa    MW: 37242 Da    PI: 7.8557
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf08351g00002.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.21.2e-141150342
                              --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                    SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                              i+++ +r++tf kR++g+ KK + LS+LCd+++++i++ +
  Peinf101Scf08351g00002.1 11 IQDHKKRKTTFLKRKAGLCKKVSQLSILCDIKACMILYQQ 50
                              8999********************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.479151IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-13164IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-18298IPR002100Transcription factor, MADS-box
CDDcd002666.57E-19288No hitNo description
PRINTSPR004043.0E-7323IPR002100Transcription factor, MADS-box
PfamPF003198.3E-151151IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGRAKIKLQL IQDHKKRKTT FLKRKAGLCK KVSQLSILCD IKACMILYQQ NIHGVVDQQE  60
IWPNDPKEVE ELINCYKKQP LEDRSKRTEN LSNFFENQKK KVKSEVAKLK KERTKYPTWD  120
SRFDSLSEVE LRNIARVLEE KIENTKRKFD FLKSNNNNND QEVWDYPELM NQTPCPTSYG  180
NNSISFIDNK WFQEFMTSGF QEFPSSGVNS LDKGNLFQEF TSGGVNSMDN GKLFQEFMRS  240
DQFQLIPSNG VNYMDNGQHT VGDYHFGINA ENWLVKNNIG AGDFYFGSSS MMQQPMELLK  300
LEYPNFTYDG STTQMPYNGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598741.13e-83PREDICTED: agamous-like MADS-box protein AGL92
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA63421232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.12e-19M-type_MADS family protein